Schaukelpferd ZJING Hlzernes Pferdemusikschaukelpferdenkinderpferdeschwimmpferd doppeltem Verwendungszweck mit lhuhnr1532-Neues Spielzeug

Sedition Wars Terrain Pack
Seeland Rainy Lady 16,5 cm, Dunkelgrün
Möglichkeiten
entdecken

Schaukelpferd ZJING Hlzernes Pferdemusikschaukelpferdenkinderpferdeschwimmpferd doppeltem Verwendungszweck mit lhuhnr1532-Neues Spielzeug

Nur wenige Branchen sind so innovationsfreudig wie die Welt der Baby- und Kleinkindausstattung: Tausende neue Produkte und immer neue Trends halten weltweit Einzug in die Kinderzimmer, spannende Ideen für Eltern und Kinder erobern die Märkte überall auf dem Globus. Sky Blau TLMYDD Multifunktionsmusik, die Klaviertastaturanfänger 1-3 Jahre altes Babykindspielzeugmädchen mit Mikrofon spielt, kann singen Kinder Keyboard Klavier (Farbe Sky Blau)Snoopy spb-860b, Kinderrucksack Wei weiDabei geht auch hier der Trend immer mehr in Richtung Design, Qualität und nicht zuletzt Umweltbewusstsein und Nachhaltigkeit.

All diese Entwicklungen treffen sich an einem Ort: der Kind + Jugend in Köln.Spark – 43pp69 – Ford Torino – Pikes Winner vielen Orten Peak 1969 – Maßstab 1 43Sanrio Sanrio Characters 1000 Peace Parade 31-407 (japan import) Mit 1.239 Ausstellern aus 49 Ländern und 24.874 Fachbesuchern aus aller Welt.

Die internationale Leitmesse für hochwertige Baby- und Kleinkindausstattung ist die perfekte Plattform für den globalen Handel und das Ordergeschäft. Schaukelstuhl Schaukelpferd Schaukelpferd Baby Früherziehung Spielzeug Musik Kinder Baby Schaukelpferd Geschenk 60 28 44 cm FANJIANI (Farbe B)Schwarz Low trumpet section Nordic Designer Schmiedeeisen Blaumenständer Wohnzimmer Einfache Sofa Kreative Seite Mehrere Regale Display-ständer, keine Notwendigkeit, Punsch ( Farbe SCHWARZ , größe Low trumpet section )Nirgendwo sonst auf der Welt wird so umfassend gezeigt, was schon morgen in allen Kinderzimmern zu finden sein wird.

Mehr erfahren

Sega DEAD OR ALIVE Extra-Sommer-Strand-Figur feat. Shunya Yamashita Dunst getrennt

Sega Lucky Strike Witches lottery prize beans 2 G Figure Collection DX whole set of 6 (japan import)

Sichern Sie sich Ihr Ticket für die Kind + Jugend im Ticket-Shop.

Jetzt Ticket online kaufen
Sideshow Collectibles G.I. Joe Destro 1 6 Scale Figure by G. I. JoeSitzscke Floor Chair mit Rückenlehne, Lazy Sofa Seating Chair für Gaming, Meditationsstuhl oder zum Lesen und Fernsehen (Farbe Style 3)

Schaukelpferd ZJING Hlzernes Pferdemusikschaukelpferdenkinderpferdeschwimmpferd doppeltem Verwendungszweck mit lhuhnr1532-Neues Spielzeug

SEJNGF Dinosauriersimulationsmodelltier Der Kinderfernbedienung Intelligenter Und Heller Junge Spielen Geschenk,Orange

Sie wollen wissen, auf welche Aussteller Sie sich bei der Kind + Jugend freuen können? Lernen Sie hier die Aussteller kennen.

SmarTrike 680-0400 Splash Dreirad Kinderdreirad, lila-wei
SEJNGF Rotierende Getriebe Bausteine Für Mnner Und Frauen Kunststoff Kinder Pdagogische Bausteine Spielzeug
Das Kind + Jugend Eventprogramm

Verschaffen Sie sich einen Überblick über Designer-Ideen, Trends und innovative Produkte im Baby- und Kleinkindbereich.

Sonny Angel Japanese Style Mini Figurine Vegetable Series Version Toy Set by Sonny Angel Sailor Moon Q posket petit vol.2 Moon single item (prize)
Schachfiguren England vs. AmerikaSchule Rucksack Trolley ,Triple Frühstücksset Mdchen Kind Pets Das Geheime Leben Der Haustiere

Selay selay1083-braun 100 cm Eros stehender Bär Plüsch Spielzeug

Kommunizieren Sie Ihren Messeauftritt: mit Online-Bannern, E-Mail-Signaturen, individuellen Social-Media-Grafiken oder personalisierten Hallenplänen inklusive Ihrer Standangabe.

Scottish Themed Ornamental Chess Set (Cream and braun, no Board)
Selfiewall Hochzeitsspiel Partyset mit 100 lustigen Fotoaufgaben & Live Diashow für Beamer

Semoic Gtx1050Ti Bild Karte 4G Battle Will Chase Gtx1060 3G 6G Spiel Diskretes Bild

Die Matchmaking365-Community der Kind + Jugend ist das Social Network der Branche. Werden Sie Teil der Matchmaking365-Community und knüpfen Sie ganzjährig wertvolle Branchen-Kontakte.

Set of 4 Madagscar 3 to 4 Figures Featuring Gloria the Hippo, Alex the Lion, Marty the Zebra, and Melman the Hypochondriac Giraffe by Madagascar SHTWAD Simulation Reborn Baby Puppe Weiche Voll Silikon 50 cm 19.7 Zoll Augen Offenen Magnetischen Mund Lebensechte Junge Mdchen Spielzeug Ourdream

Schaukelpferd ZJING Hlzernes Pferdemusikschaukelpferdenkinderpferdeschwimmpferd doppeltem Verwendungszweck mit lhuhnr1532-Neues Spielzeug

SENLUOWX Elektroauto Ride-on Mercedes Benz SLS AMG Schwarz 6V Kinderfahrzeug mit Fernbedienung Kinderauto aus Kunststoff

SENSE Innovations Motoren Geruschmodul Engine Sound System ESS-ONE für RC-Cars SENSE Innovations 15S1215C 15S1215C by partCoreSentinel SDCC Marvel Universe Masterworks 17 Inch Exclusive Action Figure by Hasbro

Aussteller aus aller Welt

Sequence Cats Game by Jax Ltd.Serie Sponge-Bob Fun - 107670000000br 481773br N

Ausstellungs- und Veranstaltungsfläche

Series 383 [Wide View Shinano] (Add-on 4-Car Set) (Model Train) (japan import)Serina Spielturm Rutsche Zubehr 2,5 m Wellenrutsche Anbaurutsche Kletterturm blau (Blau 250 cm)

Besucher haben Einfluss auf Einkaufsentscheidungen

Servo hv 7,4v digital cd7015tg - 7,4v 16kg - 0,16sec - Ritzel Titan

Sesame Street My First Electronic Game Cookie's Cookie Catch

Die nächste Messe findet vom 19. bis 22. 09. 2019 statt.

Termin vormerken